Custom Mouse anti-Human TRDV3 Monoclonal Antibody, Biotin Conjugated - 5 mg
Antigen Uniprot ID: A0JD37

Antigen Sequences:
DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVIS
PVRTEDSATYYCAF

Guaranteed Deliverables:
1. 200ug * antigen (used as positive control);
2. 25ul * Pre-immune serum (used as negative control);
3. 100ul mouse ascites fluid;
4. 5mg * Biotin conjugated monoclonal antibodies purified by Protein A/G;

Guaranteed Quality:
1. Titer of immune serum can be guaranteed 1: 10000 through in-direct ELISA before purification.
2. Antibody purity can be guaranteed above 90% by SDS-PAGE detection.
3. Antibody can be guaranteed to specifically recognize antigen through western blot assay (not available if antigen is peptide).

Lead time: ~24-32 weeks
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
icd-464TM Probe (5'FAM, 3'TAMRA) - 1x 250 nmol (Lyophilized)
Sequence (5' to 3'):
FAM-CATATTCACCTTTTCAGGCGTTTTGACCGT-TAMRA
Not Available For Sale 0.0 EUR
Cox-TM Probe (5'FAM, 3'TAMRA) - 1x 250 nmol (Lyophilized)
Sequence (5' to 3'):
FAM-AGCGAACCATTGGTATCGGACGTT-TAMRA
Not Available For Sale 0.0 EUR
icd-514R Reverse Primer - 2x 250 nmol (Lyophilized)
Sequence (5' to 3'):
CAGAATTTTCGCGGAAAATCA
Not Available For Sale 0.0 EUR
icd-439F Forward Primer - 2x 250 nmol (Lyophilized)
Sequence (5' to 3'):
CGTTATTTTACGGGTGTGCCA
Not Available For Sale 0.0 EUR
Cox-R Reverse Primer - 2x 250 nmol (Lyophilized)
Sequence (5' to 3'):
CCCCGAATCTCATTGATCAGC
Not Available For Sale 0.0 EUR
Cox-F Forward Primer - 2x 250 nmol (Lyophilized)
Sequence (5' to 3'):
GTCTTAAGGTGGGCTGGGTG
Not Available For Sale 0.0 EUR
VP72-K Probe (King), 5'FAM, 3'TAMRA - 18x 250 pmol (Lyophilized)
Sequence (5' to 3'):
FAM-CCACGGGAGGAATACCAACCCAGTG-TAMRA
Not Available For Sale 0.0 EUR
VP72-K Reverse Primer (King) - 9x 250 nmol (Lyophilized)
Sequence (5' to 3'):
GATACCACAAGATCRGCCGT
Not Available For Sale 0.0 EUR
VP72-K Forward Primer (King) - 9x 250 nmol (Lyophilized)
Sequence (5' to 3'):
CTGCTCATGGTATCAATCTTATCGA
Not Available For Sale 0.0 EUR
Recombinant Sparus aurata Fibroblast growth factor (fgf2), Active - 1 mg
Uniprot: A0A671VAT8
Expression: E.coli
Expression Region: 1-155aa (Full Length)
Tag: None
Not Available For Sale 0.0 EUR
Custom Mouse anti-Human TRDV3 Monoclonal Antibody, FITC Conjugated - 5 mg
Antigen Uniprot ID: A0JD37

Antigen Sequences:
DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVIS
PVRTEDSATYYCAF

Guaranteed Deliverables:
1. 200ug * antigen (used as positive control);
2. 25ul * Pre-immune serum (used as negative control);
3. 100ul mouse ascites fluid;
4. 5mg * FITC conjugated monoclonal antibodies purified by Protein A/G;

Guaranteed Quality:
1. Titer of immune serum can be guaranteed 1: 10000 through in-direct ELISA before purification.
2. Antibody purity can be guaranteed above 90% by SDS-PAGE detection.
3. Antibody can be guaranteed to specifically recognize antigen through western blot assay (not available if antigen is peptide).

Lead time: ~24-32 weeks
Not Available For Sale 0.0 EUR