Skip to Content
VP72-K Reverse Primer (King) - 9x 250 nmol (Lyophilized)
Sequence (5' to 3'):
GATACCACAAGATCRGCCGT
Not Available For Sale 0.0 EUR
VP72-K Forward Primer (King) - 9x 250 nmol (Lyophilized)
Sequence (5' to 3'):
CTGCTCATGGTATCAATCTTATCGA
Not Available For Sale 0.0 EUR
Recombinant Sparus aurata Fibroblast growth factor (fgf2), Active - 1 mg
Uniprot: A0A671VAT8
Expression: E.coli
Expression Region: 1-155aa (Full Length)
Tag: None
Not Available For Sale 0.0 EUR
Custom Mouse anti-Human TRDV3 Monoclonal Antibody, FITC Conjugated - 5 mg
Antigen Uniprot ID: A0JD37

Antigen Sequences:
DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVIS
PVRTEDSATYYCAF

Guaranteed Deliverables:
1. 200ug * antigen (used as positive control);
2. 25ul * Pre-immune serum (used as negative control);
3. 100ul mouse ascites fluid;
4. 5mg * FITC conjugated monoclonal antibodies purified by Protein A/G;

Guaranteed Quality:
1. Titer of immune serum can be guaranteed 1: 10000 through in-direct ELISA before purification.
2. Antibody purity can be guaranteed above 90% by SDS-PAGE detection.
3. Antibody can be guaranteed to specifically recognize antigen through western blot assay (not available if antigen is peptide).

Lead time: ~24-32 weeks
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
PeliCluster CD3 Monoclonal antibody [Clone: CLB-T3/4.E.1XE] - 1 mg
Isotype: lgE
Species: Mouse
Source: Tissue culture
Purification method: None
Not Available For Sale 0.0 EUR
SuperCult® Human Skeletal Muscle Microvascular Endothelial Cell Medium Kit - 1 kit
Kit contents:
1X Basal Medium (250mL)
1X Growth Supplement Mix (5ml)
Not Available For Sale 0.0 EUR
Avian Influenza Virus H9 Antigen rapid tests kit - 40 tests/kit
Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.3%
Specificity: 99.3%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions
Not Available For Sale 0.0 EUR
Avian Influenza Virus H7 Antigen rapid tests kit - 40 tests/kit
Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.7%
Specificity: 99.7%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions
Not Available For Sale 0.0 EUR
Avian Influenza Virus H5 Antigen rapid tests kit - 40 tests/kit
Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.3%
Specificity: 99.3%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions
Not Available For Sale 0.0 EUR