Skip to Content
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
Custom Mouse anti-Human TRDV3 Monoclonal Antibody, Biotin Conjugated - 5 mg
Antigen Uniprot ID: A0JD37

Antigen Sequences:
DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVIS
PVRTEDSATYYCAF

Guaranteed Deliverables:
1. 200ug * antigen (used as positive control);
2. 25ul * Pre-immune serum (used as negative control);
3. 100ul mouse ascites fluid;
4. 5mg * Biotin conjugated monoclonal antibodies purified by Protein A/G;

Guaranteed Quality:
1. Titer of immune serum can be guaranteed 1: 10000 through in-direct ELISA before purification.
2. Antibody purity can be guaranteed above 90% by SDS-PAGE detection.
3. Antibody can be guaranteed to specifically recognize antigen through western blot assay (not available if antigen is peptide).

Lead time: ~24-32 weeks
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
Not Available For Sale 0.0 EUR
icd-464TM Probe (5'FAM, 3'TAMRA) - 1x 250 nmol (Lyophilized)
Sequence (5' to 3'):
FAM-CATATTCACCTTTTCAGGCGTTTTGACCGT-TAMRA
Not Available For Sale 0.0 EUR
Cox-TM Probe (5'FAM, 3'TAMRA) - 1x 250 nmol (Lyophilized)
Sequence (5' to 3'):
FAM-AGCGAACCATTGGTATCGGACGTT-TAMRA
Not Available For Sale 0.0 EUR
icd-514R Reverse Primer - 2x 250 nmol (Lyophilized)
Sequence (5' to 3'):
CAGAATTTTCGCGGAAAATCA
Not Available For Sale 0.0 EUR