Recombinant Human Growth/differentiation factor 9 (GDF9), Expression: E.coli, Tag: N-terminal GST, 20 ug

https://www.gen.bg/web/image/product.template/5784/image_1920?unique=e30b97e

368,00 € 368.0 EUR 368,00 €

368,00 €

Not Available For Sale

    Questa combinazione non esiste.

    Terms and Conditions
    Garanzia di rimborso di 30 giorni
    Spedizione: 2-3 giorni lavorativi

    Purity: Greater than 90% as determined by SDS-PAGE.

    Target Names: GDF9

    Uniprot No: O60383

    Research Area: Cardiovascular

    Alternative Names: GDF9Growth/differentiation factor 9; GDF-9

    Species: Homo sapiens (Human)

    Expression system: E.coli

    Expression Region: 320-454aa

    Protein Sequence: GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

    Mol. Weight: 42.5kDa
    Protein Length: Full Length of Mature Protein
    Tag Info: N-terminal GST-tagged