gene-34085.1 Recombinant Protein expressed in E.coli - 1 mg

https://www.gentaur.be/web/image/product.template/9548/image_1920?unique=6116778
(0 review)

1.389,00 € 1389.0 EUR 1.389,00 € VAT Excluded

1.389,00 € VAT Excluded

Not Available For Sale

    Questa combinazione non esiste.

    Terms and Conditions
    Garanzia di rimborso di 30 giorni
    Spedizione: 2-3 giorni lavorativi

    Expression System: E. coli

    Expression Region: Expression Region: 1-133aa;Full Length

    Tag Information: N-terminal His Tag


    Target Protein Sequence

    Target Protein Sequence
    (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHD

    GSVWAQSSNFPQFKAEEISDIMKDFEEPGHLAP

    TGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTVK

    KTSQALVFGIYEEPVTPGQCNMVVERLGDYLVD

    QGL