Recombinant Mycobacterium tuberculosis Phosphate-binding protein (pstS1), partial - 20 ug

https://www.gentaur.be/web/image/product.template/10751/image_1920?unique=2a20a7d
(0 recensione)

0,00 € 0.0 EUR 0,00 € IVA esclusa

376,00 € IVA esclusa

info@gentaur.com

    Questa combinazione non esiste.

    Termini e condizioni
    Garanzia di rimborso di 30 giorni
    Spedizione: 2-3 giorni lavorativi

    Purity: Greater than 90% as determined by SDS-PAGE.


    Target Name: pstS1


    Uniprot No.: P9WGU0


    Alternative Names: pstS1; phoS1; MT0961; Phosphate-binding protein PstS 1; PBP 1; PstS-1; Antigen Ag78; Protein antigen B; PAB


    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)


    Source: E.coli


    Expression Region: 24-373aa


    Target Protein Sequence:

    CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS

    *Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


    Mol. Weight: 39.8 kDa


    Protein Length: Partial


    Tag Info: N-terminal 6xHis-tagged


    Form: Liquid or Lyophilized powder

    *Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.


    Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.

    *Note: If you have any special requirement for the glycerol content, please remark when you place the order.

    If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.


    Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.


    Storage Condition: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.


    Shelf Life: 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.


    Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.



    (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.